Bacterial taxon 909946
Locus STM474_3648
Protein WP_000165562.1
tryptophan--tRNA ligase
Salmonella enterica Serovar Typhimurium ST4 74
Length 334 aa, Gene trpS, UniProt E8XEI4
>WP_000165562.1|Salmonella enterica Serovar Typhimurium ST4 74|tryptophan--tRNA ligase
MTKPIVFSGAQPSGELTIGNYMGALRQWVNMQDDYHCIYCIVDQHAITVRQDAQQLRKATLDTLALYLACGIDPEKSTIFVQSHVPEHAQLGWALNCYTYFGELSRMTQFKDKSARYAENINAGLFDYPVLMAADILLYQTNLVPVGEDQKQHLELSRDIAQRFNGLYGDIFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVVKKIKRAVTDSDEPPVVRYDVKEKAGVSNLLDILSAVTGQSIPELEKQFEGKMYGHLKGEVAEAVSGMLSELQERYHRFRNDEAFLQKVMKDGAEKASARAAETLKAVYEAIGFVAKP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,658,691 | -2.52 | 0.0063 | ●●○○○ -1.13 | -1.13199654250789 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,658,111 | -2.09 | 2.1e-6 | ●○○○○ -0.91 | -0.906973278781182 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,657,767 | 1.85 | 0.013 | ○○○○○ 1.14 | 1.13916241743165 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,658,111 | -2.07 | 0.14 | ●○○○○ -0.9 | -0.89798976297356 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,658,691 | -1.79 | 0.16 | ●○○○○ -0.75 | -0.753354598597647 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,658,735 | -1.64 | 0.21 | ●○○○○ -0.67 | -0.67318855666421 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,658,691 | -1.32 | 0.075 | ●○○○○ -0.51 | -0.50751003529207 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,658,735 | -1.31 | 0.063 | ●○○○○ -0.5 | -0.503475213843817 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,658,111 | -1.26 | 0.23 | ●○○○○ -0.48 | -0.475592732782418 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,658,735 | -0.93 | 0.43 | ●○○○○ -0.3 | -0.304608687076788 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,657,767 | 1.31 | 0.45 | ○○○○○ 0.86 | 0.859274712392434 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,657,767 | 1.57 | 0.4 | ○○○○○ 0.99 | 0.994395319073251 | 23637626 |
Retrieved 12 of 12 entries in 1.4 ms
(Link to these results)