Bacterial taxon 909946
Locus STM474_3433
Protein WP_014343907.1
U32 family peptidase
Salmonella enterica Serovar Typhimurium ST4 74
Length 298 aa, Gene yhbV, UniProt E8XC92
>WP_014343907.1|Salmonella enterica Serovar Typhimurium ST4 74|U32 family peptidase
MAVRGAMKYSLGPVLYYWPKETLEDFYQQAAKSSADVIYLGEAVCSKRRATKVGDWLEMAKSLAASGKQVVLSTLALVQASSELSELKRYVDNGDFLLEASDLGVVNLCAERKLPFVAGHALNCYNAVTLRRLLKEGMVRWCMPVELSRDWLVNLLNQCDELGIRNQFEVEVLSYGHLPLAYSARCFTARSEDRPKDECETCCIKYPNGRDVLSQENQQVFVLNGIQTMSGYVYNLGNELTSMQGLVDIVRLSPLGTETFAMLDAFRANENGGAPLPLAAHSDCNGYWKRLAGLELQA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,462,289 | 1.48 | 0.042 | ○○○○○ 0.95 | 0.948100366270717 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,462,859 | -0.51 | 0.86 | ●○○○○ -0.09 | -0.0881069105616304 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,462,859 | -0.42 | 0.82 | ●○○○○ -0.04 | -0.0433153396057117 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,462,289 | 0.22 | 0.9 | ○○○○○ 0.29 | 0.289931065133302 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,462,859 | 0.28 | 0.86 | ○○○○○ 0.32 | 0.320406141336679 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,462,289 | 0.37 | 0.95 | ○○○○○ 0.37 | 0.368299580687517 | 23637626 |
Retrieved 6 of 6 entries in 17.8 ms
(Link to these results)