Bacterial taxon 909946
Locus STM474_4096
Protein WP_000771937.1
UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
Salmonella enterica Serovar Typhimurium ST4 74
Length 367 aa, Gene rfe, UniProt E8XIM8
>WP_000771937.1|Salmonella enterica Serovar Typhimurium ST4 74|UDP-N-acetylglucosamine--undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
MKLLTALSELISIFLFTTIFIFLARKVAIKIGLVDKPNFRKRHQGVIPLVGGISVFAGICFMFGLSDYYIPHLSLYLICAGVLVFVGAMDDRFDISVKIRAVVQAVIAVVMMVIAKLHLGSLGYIFGPWELVLGPFGYFLTLFAVWAAINAFNMVDGIDGLLGGLSSVSFAAMGLILWFDGQTSLAMWCFAMIAAILPYIMLNLGILGRRYKVFMGDAGSTLIGFTVIWLLLETTQGKTHSISPVTALWIIAIPLMDMVAIMYRRLRKGMSPFSPDRQHIHHLVMRAGFTSRQAFVLITLAAAILAGVGVTAEYSHFVPEWVMLVLFLLAFFLYGYCIKRAWKVARFIKRVKRRLRRQRENRPNLTK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,149,114 | -7.64 | 3.3e-24 | ●●●●○ -3.79 | -3.78906927071998 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,149,632 | -7.57 | 9.0e-10 | ●●●●○ -3.75 | -3.75239541925962 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,149,585 | -6.49 | 2.7e-15 | ●●●●○ -3.19 | -3.19118407645003 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,149,585 | -5.84 | 6.9e-8 | ●●●○○ -2.85 | -2.85390194873241 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,149,642 | -5.42 | 7.4e-7 | ●●●○○ -2.64 | -2.63765681391786 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,149,114 | -4.91 | 9.6e-5 | ●●●○○ -2.37 | -2.37266137669227 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,149,114 | -4.89 | 5.9e-6 | ●●●○○ -2.36 | -2.36355969653203 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,149,585 | -4.2 | 5.3e-5 | ●●●○○ -2 | -2.00438936725859 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,148,621 | -3.67 | 0.00065 | ●●○○○ -1.73 | -1.72732204333942 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,149,632 | -3.51 | 0.00012 | ●●○○○ -1.65 | -1.64797400881934 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,149,642 | -3.09 | 2.1e-9 | ●●○○○ -1.43 | -1.42714099691798 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,149,642 | -2.77 | 0.009 | ●●○○○ -1.26 | -1.2588513559284 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,148,621 | -1.13 | 0.13 | ●○○○○ -0.41 | -0.411671044915944 | 23637626 |
Retrieved 13 of 13 entries in 36.7 ms
(Link to these results)