Bacterial taxon 909946
Locus STM474_3758
Protein WP_000626193.1
universal stress protein UspB
Salmonella enterica Serovar Typhimurium ST4 74
Length 111 aa, Gene uspB, UniProt E8XFA3
>WP_000626193.1|Salmonella enterica Serovar Typhimurium ST4 74|universal stress protein UspB
MISTVSLFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTTHGQPNKQVRLVWYIYAQRYRDHHDEEFIRRCERVRRQFLLTSALCGLVVVSLIALMIWH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,781,789 | 1.57 | 0.046 | ○○○○○ 0.99 | 0.993054683709549 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,781,766 | 0.62 | 0.75 | ○○○○○ 0.5 | 0.501574102985307 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,781,766 | 1.09 | 0.81 | ○○○○○ 0.74 | 0.742869439202289 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,781,789 | 1.8 | 0.3 | ○○○○○ 1.11 | 1.11020365297285 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,781,789 | 2.42 | 0.27 | ○○○○○ 1.44 | 1.43598287182483 | 23637626 |
Retrieved 5 of 5 entries in 11.2 ms
(Link to these results)