Bacterial taxon 909946
Locus STM474_3861
Protein WP_000665687.1
YibL family ribosome-associated protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 120 aa, Gene yibl, UniProt E8XG03
>WP_000665687.1|Salmonella enterica Serovar Typhimurium ST4 74|YibL family ribosome-associated protein
MKEVEKNEIKRLSDRLDAIRHQQAGLSLVESADKYAELEKEKETLEAEIIRLREVHSQKLSKEAQKLMNLPFRRAITKKEQADMGKLKKSVRGLIVVHPMTALGREMGLKEMTGFAKSEF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,901,037 | -2.44 | 9.7e-7 | ●●○○○ -1.09 | -1.09234284759089 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,901,037 | -2.36 | 0.036 | ●●○○○ -1.05 | -1.05045589268024 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,901,037 | -1.37 | 0.2 | ●○○○○ -0.53 | -0.53494986754421 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,901,325 | -1.04 | 0.58 | ●○○○○ -0.36 | -0.361657996040526 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,901,325 | 0.17 | 0.92 | ○○○○○ 0.27 | 0.26550348157649 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,901,325 | 0.84 | 0.12 | ○○○○○ 0.61 | 0.61311429356365 | 23637626 |
Retrieved 6 of 6 entries in 1.6 ms
(Link to these results)