Bacterial taxon 909946
Locus STM474_4311
Protein WP_000813834.1
YijD family membrane protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 119 aa, Gene yijD, UniProt E8XL83
>WP_000813834.1|Salmonella enterica Serovar Typhimurium ST4 74|YijD family membrane protein
MKQSGQDKGTLLLALIAGLSINGTFAALFSAIVPFSVFPIISLVLTVYCLHQRYQNRTMPVGLPGLAAACFILGVLLYSTVVRAEYPDIGSNFFPAVLSVILVFWIGFKLRNRKQDTAE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,367,818 | 2.1 | 0.005 | ○○○○○ 1.27 | 1.26857685677967 | 23637626 |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,368,022 | -0.04 | 0.98 | ○○○○○ 0.16 | 0.156447314569055 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,368,022 | 0.72 | 0.85 | ○○○○○ 0.55 | 0.549009778871891 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,368,022 | 0.73 | 0.56 | ○○○○○ 0.55 | 0.55380330822398 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,367,818 | 0.78 | 0.82 | ○○○○○ 0.58 | 0.584439208407167 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,367,818 | 1.07 | 0.38 | ○○○○○ 0.73 | 0.734912147449405 | 23637626 |
Retrieved 6 of 6 entries in 1.7 ms
(Link to these results)