Bacterial taxon 909946
Locus STM474_3344
Protein WP_000115874.1
zinc transporter ZupT
Salmonella enterica Serovar Typhimurium ST4 74
Length 257 aa, Gene ygiE, UniProt E8XBB9
>WP_000115874.1|Salmonella enterica Serovar Typhimurium ST4 74|zinc transporter ZupT
MSVPLILTLLAGAATFIGAFLGVLGQKPSNRVLAFSLGFAAGIMLLISLMEMLPAALDTEGMSPVLGYGMFIIGLLGYFGLDRLLPHAHPQDLVQKRQQPLPGSIKRTAILLTLGISLHNFPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAIFWAGISGMAEILGGVLAWLILGSLVSPIVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCGMSIMGLSLVILQTIGIG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,374,517 | 2.06 | 0.0097 | ○○○○○ 1.25 | 1.24810342795734 | 23637626 |
Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,374,517 | -1.9 | 0.095 | ●○○○○ -0.81 | -0.808899114217353 | 23637626 |
Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,374,517 | 1.02 | 0.71 | ○○○○○ 0.71 | 0.708583461230614 | 23637626 |
Retrieved 3 of 3 entries in 2.4 ms
(Link to these results)