Bacterial taxon 909946
Locus STM474_4435
Protein WP_000416272.1
zinc uptake transcriptional repressor Zur
Salmonella enterica Serovar Typhimurium ST4 74
Length 171 aa, Gene zur, UniProt E8X903
>WP_000416272.1|Salmonella enterica Serovar Typhimurium ST4 74|zinc uptake transcriptional repressor Zur
MEKTTTQELLAQAEKLCAQRNVRLTPQRLEVLRLMSLQQGAISAYDLLDLLRETEPQAKPPTIYRALDFLLEQGFVHKVESTNSYVVCHLFDQPTHSSAMFICDRCGVVKEECAEGVEDIMHTLAAKMGFALRHNVIEAHGLCPACVEVEACRHPGNCGHDHSVLVKKKPR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,483,115 | -2.51 | 0.005 | ●●○○○ -1.12 | -1.12399127905753 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,483,115 | -2.18 | 0.056 | ●○○○○ -0.96 | -0.956596238690398 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,483,115 | 0.09 | 0.9 | ○○○○○ 0.22 | 0.224120313878059 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)