Bacterial taxon 615
Locus BVG96_18255
Protein ASL99448.1
chorismate lyase
Serratia marcescens Strain UMH9
Length 171 aa, Gene n/a, UniProt n/a
>ASL99448.1|Serratia marcescens Strain UMH9|chorismate lyase
MSGIRDSILPPLEWLSEQDPPAPAAVSDWLMELGSMTRRFERHCAQVRVEPQRECFVTREALGDEAKHLPDSPRYWLREVVLLGDDQPWLLGRTVIPENTLTGPDQALVDLGTLPLGRYLFSSGELTRDYIHIGRQDALWARRSRLRLAGKPLLLTELFLPASPLYSAVPA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -2.76 | 0.0025 | ●●●●○ -3.27 | -3.265050811149609 | 28536292 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)