Bacterial taxon 615
Locus BVG96_14880
Protein ASL98833.1
co-chaperone HscB
Serratia marcescens Strain UMH9
Length 173 aa, Gene n/a, UniProt n/a
>ASL98833.1|Serratia marcescens Strain UMH9|co-chaperone HscB
MDYFTLFGLPVRYTVDGSLLASRFQDLQRQFHPDRFANQPERERLMALQQAATINEAYQSLKHPLKRAEYMLSLHGFELGNEQHTMRDTAFLMEQLELREELDAIERKPEAESLLADFGARLAVSIKQRSALMLQQLDGELWADAADTVRKLRFLDKLQQQVEQLEEKLLGFE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -2.21 | 0.0042 | ●●●○○ -2.64 | -2.6366230318116255 | 28536292 |
Retrieved 1 of 1 entries in 11.8 ms
(Link to these results)