Bacterial taxon 615
Locus BVG96_00185
Protein ASL96124.1
Co2+/Mg2+ efflux protein ApaG
Serratia marcescens Strain UMH9
Length 125 aa, Gene n/a, UniProt n/a
>ASL96124.1|Serratia marcescens Strain UMH9|Co2+/Mg2+ efflux protein ApaG
MIDSPRVCIQVQSIYVESQSIPEEERYVFAYTITIRNLGRTDVQLLGRYWLITNSNGRQTEVQGEGVIGEQPVIPPGGEFQYTSGAILETPLGTMEGHYEMVDHQGQPFRTAIPVFRLAIPTLIH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -3.71 | 1.4e-7 | ●●●●● -4.36 | -4.357477278642123 | 28536292 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)