Bacterial taxon 615
Locus BVG96_10430
Protein ASL98010.1
crossover junction endodeoxyribonuclease RuvC
Serratia marcescens Strain UMH9
Length 173 aa, Gene n/a, UniProt n/a
>ASL98010.1|Serratia marcescens Strain UMH9|crossover junction endodeoxyribonuclease RuvC
MAIILGIDPGSRVTGYGLIRQQGRQLSYIASGCIRTVVDDMPTRLKLIYAGVSEIITQFQPDFFAIEQVFMAKNPDSALKLGQARGVAIVAAVNQNLEVFEYAARQVKQTVVGTGAAEKAQVQHMVRSLLKLSANPQADAADALAIAITHCHLSQNVLRMSEGRLNLARGRLR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -4.65 | 7.0e-10 | ●●●●● -5.43 | -5.42977843971006 | 28536292 |
Retrieved 1 of 1 entries in 31.7 ms
(Link to these results)