Bacterial taxon 615
Locus BVG96_22840
Protein ASM00271.1
DNA polymerase III subunit chi
Serratia marcescens Strain UMH9
Length 149 aa, Gene n/a, UniProt n/a
>ASM00271.1|Serratia marcescens Strain UMH9|DNA polymerase III subunit chi
MKQATFYLLDNAEPSGALSAHEAVACAVAANGFRSGKRVLIACESQEQAQRLDEALWQREPHEFVPHNLAGEGPHYGAPVELCWPGKRGNAPRDLLIALLPQFADFATAFHEVVDFVPYEDTLKQLARDRYKAYRSVGFHLTTATPPTH
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -3.41 | 0.0022 | ●●●●● -4.01 | -4.006385454365572 | 28536292 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)