Bacterial taxon 615
Locus BVG96_13140
Protein ASL98514.1
DNA-binding response regulator
Serratia marcescens Strain UMH9
Length 216 aa, Gene n/a, UniProt n/a
>ASL98514.1|Serratia marcescens Strain UMH9|DNA-binding response regulator
MNNLNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLSKLDANVLITDLSMPGDKYGDGITLIKYIKRHYPQLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSKLLEKISASGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVSMTPLDKD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -4.05 | 1.2e-7 | ●●●●● -4.74 | -4.743619344455989 | 28536292 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)