Bacterial taxon 615
Locus BVG96_04615
Protein ASL96926.1
dTDP-4-dehydrorhamnose 3,5-epimerase
Serratia marcescens Strain UMH9
Length 177 aa, Gene n/a, UniProt n/a
>ASL96926.1|Serratia marcescens Strain UMH9|dTDP-4-dehydrorhamnose 3,5-epimerase
MKVIDTKIAGVKVIEPKIFGDQRGFFFETFQKQRYQELLDIEHDFVQDNYSRSTRGVLRGLHFQTSRPQGKLVYTLRGEVYDVVVDIRPNSPSFKQWLGINLSEGNKKQLWIPPGLAHGFLVLSDEVDFAYKCTDYYDPKNEHCLSWNDPELAIEWPIEHPQLSEKDLKGKLFSELF
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -2.38 | 0.027 | ●●●○○ -2.83 | -2.8261107438489717 | 28536292 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)