Bacterial taxon 615   Locus BVG96_04615   Protein ASL96926.1

dTDP-4-dehydrorhamnose 3,5-epimerase

Serratia marcescens Strain UMH9

Length 177 aa, Gene n/a, UniProt n/a

>ASL96926.1|Serratia marcescens Strain UMH9|dTDP-4-dehydrorhamnose 3,5-epimerase
MKVIDTKIAGVKVIEPKIFGDQRGFFFETFQKQRYQELLDIEHDFVQDNYSRSTRGVLRGLHFQTSRPQGKLVYTLRGEVYDVVVDIRPNSPSFKQWLGINLSEGNKKQLWIPPGLAHGFLVLSDEVDFAYKCTDYYDPKNEHCLSWNDPELAIEWPIEHPQLSEKDLKGKLFSELF

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus C57BL/6)spleen BTO:000128124 hnot available in this study-2.380.027●●●○○ -2.83-2.826110743848971728536292
Retrieved 1 of 1 entries in 0.6 ms (Link to these results)