Bacterial taxon 615
Locus BVG96_02665
Protein ASL96570.1
LexA regulated protein
Serratia marcescens Strain UMH9
Length 95 aa, Gene n/a, UniProt n/a
>ASL96570.1|Serratia marcescens Strain UMH9|LexA regulated protein
MAKEQTDRTTLDLFADERRPGRPKTNPLSRDEQLRINKRNQLRRDKVRGLRRVELKINADAVDALNKLAEQRNISRSELIEQMLLAQLAEEQPEH
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -4.26 | 4.4e-8 | ●●●●● -4.98 | -4.983654446376772 | 28536292 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)