Bacterial taxon 615
Locus BVG96_07845
Protein ASL97531.1
mannose-6-phosphate isomerase
Serratia marcescens Strain UMH9
Length 392 aa, Gene n/a, UniProt n/a
>ASL97531.1|Serratia marcescens Strain UMH9|mannose-6-phosphate isomerase
MQKMTNAVQNYAWGSHDALTRLYGIANPDNLPMAELWMGAHPKSPSRVPGADGELRSLRDLIDEDQPKQLGTNVASRFGELPFLFKVLCADQPLSIQVHPSKAAAEIGFAKENAAGIPLSAAERNYKDPNHKPELVFALTPFLAMNGFRELADIVSLLQPIAGAHHDIAAFLQQPDTAHLATLFASLLTMSGEQKSLALGVLKAALNNQQGEPWDTVRFIAGFYPDDSGLFSPLLLNVVQLAPGEAMFLYAETPHAYLKGVALEVMANSDNVLRAGLTPKFIDVPELLANLQFRPQPASGLLTQPEPRGNELFFPIPVEDFAFSLHDLTTAPQALAQQSAAIVFCVTGEATLEKSGQRLTLKPGESCFIGAFESPVNVSGSGRIARVYNQLA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -2.49 | 0.0082 | ●●●○○ -2.96 | -2.9604502051221298 | 28536292 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)