Bacterial taxon 615
Locus BVG96_02965
Protein ASL96618.1
phosphoglyceromutase
Serratia marcescens Strain UMH9
Length 250 aa, Gene n/a, UniProt n/a
>ASL96618.1|Serratia marcescens Strain UMH9|phosphoglyceromutase
MAVTKLVLVRHGESQWNQENRFTGWYDVDLSDKGRTEAKAAGKLLKEEGFTFDFAYTSVLKRAIHTLWNILDELDQAWLPTEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKEDERYPGHDPRYASLTEQELPLTESLALTIDRVIPYWDEEILPRIKSGERVIVAAHGNSLRALVKYLDNLSEDEILELNIPTGVPLVYEFDENFKPTKRYYLGNADEIAAKAAAVANQGKAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -2.1 | 0.035 | ●●●○○ -2.5 | -2.504304772452612 | 28536292 |
Retrieved 1 of 1 entries in 32.3 ms
(Link to these results)