Bacterial taxon 615
Locus BVG96_22480
Protein ASM00207.1
RNA-binding protein
Serratia marcescens Strain UMH9
Length 97 aa, Gene n/a, UniProt n/a
>ASM00207.1|Serratia marcescens Strain UMH9|RNA-binding protein
MNLNNKQKQHLKGLAHPLKPVVMLGNNGLTEGVLAEIEQALEHHELIKVKIAAEDRETKTLIADAIVRETGACNVQVIGSTLILYRPSKERKISLPR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -4.73 | 1.9e-7 | ●●●●● -5.52 | -5.524157209194885 | 28536292 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)