Bacterial taxon 615
Locus BVG96_04230
Protein ASL96855.1
type-1 fimbrial protein subunit
Serratia marcescens Strain UMH9
Length 180 aa, Gene n/a, UniProt n/a
>ASL96855.1|Serratia marcescens Strain UMH9|type-1 fimbrial protein subunit
MKKVLLPLAALVLSATASNAMAANGTVKFTGEIKQSTCQVTSDTQNKEVYLGTYPTSAFPTVGSKSASKAFQISLEKCDAGDYSLRFDGNTVAGNPDLLSVSNVGGTGAAATGVGIEITDNNGKPFAIGDGSNINDDVAKVTIAADGKATFNLQARYRSFDSNVTAGLANATSPFTIEYK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | 1.87 | 0.031 | ○○○○○ 2.04 | 2.0394094978228376 | 28536292 |
Retrieved 1 of 1 entries in 29.5 ms
(Link to these results)