Bacterial taxon 301447 Locus SP5448_06590 Protein WP_011285473.1

ABC transporter ATP-binding protein

Streptococcus pyogenes M1 5448

Length 222 aa, Gene n/a, UniProt n/a

					>WP_011285473.1|Streptococcus pyogenes M1 5448|ABC transporter ATP-binding protein
MSVLTFKQVTKTFQDGHHEINALKATDFSIEAGEFVAIIGPSGSGKSTFLTIAGGLQTPSSGQLIIDGTDYTHLSEKERSRLRFKSVGFILQASNLIPFLTVQQQLELVDHLTGSKEKAKANQLFDDLGITGLKHQLPQELSGGERQRAAIARALYHDPALILADEPTASLDTEKAYEVVKLLAKESKEKNKAIIMVTHDDRMLKYCDKVYRMQDGELCQER
				

Host	Tissue	Tissue Ontology	Time Post Infection	Transposon Insertion Site	Raw Fitness Score	p-Value	Fitness z-Score	Precise fitness z-Score	Reference
Mouse (Mus musculus Crl:SKH1-hrBR)	skin	BTO:0001253	48 h	not available in this study	-3.69	0.00085	●●●●○ -3.45	-3.4475292403793993	28832676
Mouse (Mus musculus Crl:SKH1-hrBR)	skin	BTO:0001253	12 h	not available in this study	-1.22	0.21	●●○○○ -1.08	-1.0759120996535365	28832676
Mouse (Mus musculus Crl:SKH1-hrBR)	skin	BTO:0001253	24 h	not available in this study	0.27	0.78	○○○○○ 0.35	0.35359527296882187	28832676

Retrieved 3 of 3 entries in 17.5 ms (Link to these results)