Bacterial taxon 301447   Locus SP5448_02680   Protein WP_011285663.1

bacteriocin immunity protein

Streptococcus pyogenes M1 5448

Length 88 aa, Gene n/a, UniProt n/a

>WP_011285663.1|Streptococcus pyogenes M1 5448|bacteriocin immunity protein
MEKKRQRLYDVIRQAYDYPENRENVALSQLLLAASNRLIKHSNPLLVAYQLNQDVDNYLLDNDILLPKSLCRFKQSLEKYILEEASLV

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125348 hnot available in this study2.160.044○○○○○ 2.172.17436660030355428832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125312 hnot available in this study0.020.99○○○○○ 0.110.1122901985895762428832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125324 hnot available in this study0.310.76○○○○○ 0.40.397047682681350828832676
Retrieved 3 of 3 entries in 1.1 ms (Link to these results)