Bacterial taxon 301447   Locus SP5448_00670   Protein WP_002992749.1

DUF4651 domain-containing protein

Streptococcus pyogenes M1 5448

Length 94 aa, Gene n/a, UniProt n/a

>WP_002992749.1|Streptococcus pyogenes M1 5448|DUF4651 domain-containing protein
MSKKKIGMISGIFGFSLAIGLGIVIKDYCQDRQRRQMTRDLRTFFSPLGQIEVLYINPCQVKQDYISGGVVMSNGKQYQFTYHSRQISFEEDKG

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125324 hnot available in this study-2.690.013●●●○○ -2.49-2.488115415310728628832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125312 hnot available in this study-0.980.38●○○○○ -0.84-0.844902939168565128832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125348 hnot available in this study0.30.79○○○○○ 0.380.384934842805734328832676
Retrieved 3 of 3 entries in 1.7 ms (Link to these results)