Bacterial taxon 301447   Locus SP5448_04360   Protein WP_011285584.1

helix-turn-helix transcriptional regulator

Streptococcus pyogenes M1 5448

Length 274 aa, Gene n/a, UniProt n/a

>WP_011285584.1|Streptococcus pyogenes M1 5448|helix-turn-helix transcriptional regulator
MKLGEIIKNFREEKKLSMDRFAEKSGLTKGYISMLEKNEHPKSKKPIIPTEETLLKVAKGMGVDIDFVLSKLDSDQEIQINISPKNMLNMDNPSTPTTPKVELIPSTLQKINSTSSQLEHSRQIIVLDTAETLLEQQKEIKNNEDTIAELFSYNYYDHAASAGTGQYLNDVQVEKIELPVDYDADFVIPVYGDSMEPKYHSGDYVFVKLSVELTDGDIGVFEYYGDAYIKQLLINDEGAFLHSLNSKYEDIPIDRDSDFRIIGEVVGSYSGNHS
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125348 hnot available in this study2.10.015○○○○○ 2.112.113802400925471728832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125312 hnot available in this study0.970.21○○○○○ 1.031.02951096475818328832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125324 hnot available in this study1.490.055○○○○○ 1.531.532193819596267428832676
Retrieved 3 of 3 entries in 16.9 ms (Link to these results)