Bacterial taxon 301447   Locus SP5448_03505   Protein WP_010922204.1

hypothetical protein

Streptococcus pyogenes M1 5448

Length 88 aa, Gene n/a, UniProt n/a

>WP_010922204.1|Streptococcus pyogenes M1 5448|hypothetical protein
MEEKKFFTTYEMDLMNSVVTLQKSILTQTEHLSDQLTKKLHHLEDYNSPIDDEAIRLAEVTAEFYKLLIKSPSVGATVKEIVSEGHKR
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125348 hnot available in this study2.440.037○○○○○ 2.452.446424829255892828832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125324 hnot available in this study-1.240.29●●○○○ -1.1-1.095138829614832628832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125312 hnot available in this study-0.260.83●○○○○ -0.15-0.1492798491688753528832676
Retrieved 3 of 3 entries in 6.5 ms (Link to these results)