Bacterial taxon 301447   Locus SP5448_08740   Protein WP_002982472.1

hypothetical protein

Streptococcus pyogenes M1 5448

Length 83 aa, Gene n/a, UniProt n/a

>WP_002982472.1|Streptococcus pyogenes M1 5448|hypothetical protein
MIKKVTTPSQKTKKRVRNGYLLKLGTACLLLSILSYGIGLLGQPSMENTFMGIASVAMLGSVCFFIIFALNRIFDALEDNLRD
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125324 hnot available in this study-2.660.0017●●●○○ -2.46-2.455429974376525328832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125348 hnot available in this study-1.480.1●●○○○ -1.32-1.323936916154255128832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125312 hnot available in this study-0.080.93○○○○○ 0.020.0242606154617824528832676
Retrieved 3 of 3 entries in 446 ms (Link to these results)