Bacterial taxon 301447   Locus SP5448_00935   Protein WP_002987909.1

L-ribulose-5-phosphate 3-epimerase

Streptococcus pyogenes M1 5448

Length 287 aa, Gene n/a, UniProt n/a

>WP_002987909.1|Streptococcus pyogenes M1 5448|L-ribulose-5-phosphate 3-epimerase
MARPIGIYEKATPKQFTWRERLQFAKDLGFDFVEMSVDESDARLARLEWTKEERLDLVKAIYETGIRIPTICFSGHRRYPLGSNDPAIEAKSLKLMKQCIELAQDLGVRTIQLAGYDVYYEEKSPETRARFIKNLRQSCDWAEEAQVMLSIEIMDDPFINSIEKYLAVEKEIDSPYLFVYPDAGNVSAWHNDLWSEFYNGHKSIAALHLKDTYAVTETSKGQFRDVPFGQGCVDWQELFAVLKKTNYNGPFLIEMWSENCDTVEETKAAIKEAQDFLYPLIEKAGLA
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125324 hnot available in this study-3.890.00027●●●●○ -3.64-3.63883520349429528832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125348 hnot available in this study-1.970.074●●○○○ -1.8-1.795953136704072428832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125312 hnot available in this study-1.960.065●●○○○ -1.79-1.788262444719553928832676
Retrieved 3 of 3 entries in 1.4 ms (Link to these results)