Bacterial taxon 301447   Locus SP5448_07980   Protein WP_010921916.1

metallophosphoesterase

Streptococcus pyogenes M1 5448

Length 173 aa, Gene n/a, UniProt n/a

>WP_010921916.1|Streptococcus pyogenes M1 5448|metallophosphoesterase
MASKTIIVMSDSHGDRDIVQAIKDKYLGQVDAIFHNGDSELNSSDPIWAGIYVVGGNCDYDTGYPDRLVTQLGTVTIAQTHGHLYHINFTWDKLDYFAQEVVADICLYGHLHRPAAWQVGQTLFMNPGSVTQPRGEINEKLYARVELTDTQIKVDYFTRDHKLYPSLSKEFKR

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125348 hnot available in this study-2.330.038●●●○○ -2.15-2.146840958497724428832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125324 hnot available in this study-1.060.33●○○○○ -0.92-0.924020932959298228832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125312 hnot available in this study-0.210.85●○○○○ -0.11-0.1055390385069269528832676
Retrieved 3 of 3 entries in 2.4 ms (Link to these results)