Bacterial taxon 301447   Locus SP5448_02900   Protein WP_010922536.1

response regulator transcription factor

Streptococcus pyogenes M1 5448

Length 213 aa, Gene n/a, UniProt n/a

>WP_010922536.1|Streptococcus pyogenes M1 5448|response regulator transcription factor
MSKIKVILVDDHEMVRMGLKSFLNLQADIDVVGEASNGREGVDLALALKPDVLVMDLVMPELGGVEATLEVLKKWKEAKVLVLTSYLDNEKIYPVIDAGAKGYMLKTSSAAEILNAIRKVSKGELAIETEVDKKIKAHDQHPDLHEELTAREYDILHLLAKGYDNQTIADELFISLKTVKTHVSNILAKLEVGDRTQAVVYAFRHHLVPQDDN

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125348 hnot available in this study2.140.024○○○○○ 2.152.150333187851934328832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125324 hnot available in this study-0.680.43●○○○○ -0.55-0.553233445655704528832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125312 hnot available in this study0.390.66○○○○○ 0.470.46857111813737228832676
Retrieved 3 of 3 entries in 1.6 ms (Link to these results)