Bacterial taxon 301447   Locus SP5448_05220   Protein WP_010922309.1

VOC family protein

Streptococcus pyogenes M1 5448

Length 137 aa, Gene n/a, UniProt n/a

>WP_010922309.1|Streptococcus pyogenes M1 5448|VOC family protein
MKLNAIHHVAIIVSDYHLSKDFYVNKLGFEIIRENYRPDKHDYKLDLSCGRIELEIFGKVTSDPNYQAPPKRVSEPEFKSEACGLRHLAFRVTNIESYVDDLKSLGIPVEPIRHDDYTGEKMTFFFDPDGLPLELHE
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125348 hnot available in this study-2.960.013●●●○○ -2.74-2.743830923795965528832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125312 hnot available in this study-2.030.077●●○○○ -1.85-1.854594663086024828832676
Mouse (Mus musculus Crl:SKH1-hrBR)skin BTO:000125324 hnot available in this study-1.720.13●●○○○ -1.55-1.553696339191742728832676
Retrieved 3 of 3 entries in 12 ms (Link to these results)