Bacterial taxon 243277
Locus VC_0342
Protein NP_229996.1
(Fe-S)-binding protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 369 aa, Gene queG, UniProt Q9KV16
>NP_229996.1|Vibrio cholerae O1 biovar El Tor str. N16961|(Fe-S)-binding protein
MDYQQLANQIKQWAIELGFEKVGICDVDLSEHEPALQAWLDAGYHGEMDWMARHGMMRARPAELLPGTLRVISARINYLPPQAQFASNLSDPNQAYISRYALGRDYHKLVRNQLKKLGEKIEQEVGKLGYRPFVDSAPILERPLAQKAGLGWTGKHSLILDKENGSWFFLGELLVDIPLPVDEPSENQCGKCTACITSCPTNAIVAEGVVDARRCVSYLTIEYSGVIPLEFRRAMGNRIYGCDDCQLVCPWNRFAPLTQQSDFHRRQSLNNADLVVLFEWDEATFLKNMEGSAIRRIGHQQWRRNLIIAMGNAPYSPRIIDTLQRHLGQSELLDEHIHWALEEQTQKTATPRQHARLIRIIEKGLPRDA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.72 | 0.0031 | ○○○○○ 1.2 | 1.1995335328523409 | 24331463 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)