Bacterial taxon 243277
Locus VC_1640
Protein NP_231277.1
50S ribosomal protein L25
Vibrio cholerae O1 biovar El Tor str. N16961
Length 92 aa, Gene rplY, UniProt Q9KRK0
>NP_231277.1|Vibrio cholerae O1 biovar El Tor str. N16961|50S ribosomal protein L25
MKFEAVLRTDLGKGASRRLRNTGYFPAIVYGGEAAPVSISLNHDDVMNQMDKPEFYEAIVLVIDGQEVKVKPQDVQRHAYKPKVEHMDFIRI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -4.16 | 4.5e-9 | ●●○○○ -1.51 | -1.5134782474395396 | 24331463 |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)