Bacterial taxon 243277
Locus VC_A0855
Protein NP_233241.1
ABC transporter ATP-binding protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 227 aa, Gene n/a, UniProt Q9KL91
>NP_233241.1|Vibrio cholerae O1 biovar El Tor str. N16961|ABC transporter ATP-binding protein
MLHFQSIEKQYSLGVQSVPALRGVSGVVQQGEMLALCGPSGSGKSTLLNILGLLDPNYQGEVALEGRVYPRKGKSAALLRRTQFGFVFQKFNLVSVMTALENVAYPLMLNGFSRRDQHKLAHDMLTKVGLEAVMQQRPDHLSGGQQQRVAIARALVHNPKLVVADEPTASLDSQTANLVISLMKSLGHELGTTFVVATHDGRMAAQCDRTLNLVDGQISLEAMQWAS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.53 | 0.0022 | ○○○○○ 0.7 | 0.7043920305275176 | 24331463 |
Retrieved 1 of 1 entries in 5.2 ms
(Link to these results)