Bacterial taxon 243277
Locus VC_0248
Protein NP_229905.1
acyl carrier protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 80 aa, Gene n/a, UniProt Q9KVA1
>NP_229905.1|Vibrio cholerae O1 biovar El Tor str. N16961|acyl carrier protein
MVYMSISEEKIINLIAGILEVEIGIINKELAVGDIPEWDSLAHMRIIAALESDLGVVLDIEQVLEIEDVEDIIDAVINNE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -9.09 | 8.7e-15 | ●●●●○ -3.79 | -3.7893429124992473 | 24331463 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)