Bacterial taxon 243277
Locus VC_A0512
Protein NP_232903.1
anaerobic ribonucleotide reductase-activating protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 155 aa, Gene nrdG, UniProt Q9KM76
>NP_232903.1|Vibrio cholerae O1 biovar El Tor str. N16961|anaerobic ribonucleotide reductase-activating protein
MNYHQYYPIDVVNGPGTRCTLFVSGCVHQCKGCYNQSTWSLSSGHRYTQEMEDKIIADLKDTRIKRRGLSLSGGDPMHPANLSAVLQLVQRVKTECPDKDIWLWTGYTLAELDDSQQALLPYIDVLVDGKFIQEQADPGLEWRGSANQVIHRFTL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 2.34 | 0.026 | ○○○○○ 1.86 | 1.8635198257995613 | 24331463 |
Retrieved 1 of 1 entries in 2.3 ms
(Link to these results)