Bacterial taxon 243277
Locus VC_1003
Protein NP_230649.1
bacteriocin production protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 163 aa, Gene n/a, UniProt Q9KTA0
>NP_230649.1|Vibrio cholerae O1 biovar El Tor str. N16961|bacteriocin production protein
MNWLDIVILSVIGLSALISLVRGFAKEALSLVIWFGAFYIASEYYAKLAVYFTNIKDDMFRNGAAIAALFVATLIVGAIVNYVIAQLVEKTGLSGTDRILGVVFGALRGVLIVAAGLFFMDAFTAFPNTEWWKSSQLVPEFSRVIAPFFEHLKATSSFLSGAI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -7.13 | 5.2e-12 | ●●●○○ -2.88 | -2.883874130683325 | 24331463 |
Retrieved 1 of 1 entries in 86.9 ms
(Link to these results)