Bacterial taxon 243277
Locus VC_1725
Protein NP_231361.1
beta-ketoadipate enol-lactone hydrolase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 272 aa, Gene n/a, UniProt Q9KRB7
>NP_231361.1|Vibrio cholerae O1 biovar El Tor str. N16961|beta-ketoadipate enol-lactone hydrolase
MSSPMTAIAEKVLFHKTYLHPTSQEWVVFVHGAGGSSSIWFKQIKAYRQHFNLLLIDLRGHGKSNQLLRDWIANRYTFKTVTLDVLKVLDHLKIQSAHFVGMSLGTIIVRNLAELATHRVNSMVLGGAVTRLNARSQVLVKLGHLSKHLIPYMWLYRLFAYIVMPQRSQKESRHLFIREAQKLCQKEFKRWFTLTAEVNPLMRYFRDRELPIPTLYLMGEKDYMFIHPVKEMVALHAQSELYEIPNCGHVCNVEQPELFNQRSIEFIQRQIR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.51 | 0.0012 | ○○○○○ 1.1 | 1.1021682115933222 | 24331463 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)