Bacterial taxon 243277
Locus VC_A0798
Protein NP_233184.1
CbbY family protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 226 aa, Gene n/a, UniProt Q9KLE8
>NP_233184.1|Vibrio cholerae O1 biovar El Tor str. N16961|CbbY family protein
MTESRVKCVIFDCEGTLVDSERLCCEALVQVFGELGVALSYQQVAEHFSGGKIADILHAACQLAKITADIDLLEQRYRSIVAATFRRKLSPMGGARALLNYLKRNQIEFCVASNAPREKIAMTLTLAGLEHYFEGRIFSAFDANSWKPEPDLIRYCAMNMGFTLDECIYVDDTPKGVEAGLNAEVLTFQLSPLNPQHRSHSQQVIVLSNLLQLAEYLSGSVMRQSA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.67 | 0.02 | ○○○○○ 0.8 | 0.7965989724729773 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)