Bacterial taxon 243277
Locus VC_A0538
Protein NP_232928.1
cytochrome b561
Vibrio cholerae O1 biovar El Tor str. N16961
Length 181 aa, Gene n/a, UniProt Q9KM51
>NP_232928.1|Vibrio cholerae O1 biovar El Tor str. N16961|cytochrome b561
MKNSDSQHYNLVTRSIHWISALVVIGMFAVGTWMMDLSYYSEWYRTAPHWHKSVGLLLAGLTLFRLIWKALSSSPKIEGARWEIVAAKSAHHLMYVGLFVLFVSGYLISTEDGRGIEVFNWFTVPGAGALFENQADIAGNIHFYTAWGLIILAGLHAVAALKHHFINRDNTLRKMLTGASK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.13 | 0.0036 | ●●○○○ -1.65 | -1.6462901251713797 | 24331463 |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)