Bacterial taxon 243277
Locus VC_0168
Protein NP_229825.1
cytochrome c5
Vibrio cholerae O1 biovar El Tor str. N16961
Length 135 aa, Gene n/a, UniProt Q9KVH8
>NP_229825.1|Vibrio cholerae O1 biovar El Tor str. N16961|cytochrome c5
MDMSRSLLSVLFAALTFSTAAFALTEADKNAIAERIKPVGDVYLAGSEPVQAAPTGPRDGATVYGTFCTACHSAGISGAPKTGNAADWGPRIAQGKDVLKNHALNGFNAMPPKGTCMDCSDDEIVAAIEHMIAGL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.18 | 6.0e-9 | ●●○○○ -1.06 | -1.0615690961870594 | 24331463 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)