Bacterial taxon 243277
Locus VC_1290
Protein NP_230935.1
DNA polymerase III subunit epsilon
Vibrio cholerae O1 biovar El Tor str. N16961
Length 236 aa, Gene n/a, UniProt Q9KSG6
>NP_230935.1|Vibrio cholerae O1 biovar El Tor str. N16961|DNA polymerase III subunit epsilon
MSAMFDSAIYWPARFAHLAQQARQTHLQRFYAQPLVEGSTPIHQCSLVALDFETTGLNAEQDAIVSIGLVPFTTQRIFLSQARYWLVKPSQPLEDESIVFHGITHSELQHAQAPEQVLKELLEALHGKIVVVHFRHIERDFLRQISLNIWGEAIEFPVLDTLEIERQLLDKQRSLWQRIARRPLPSIRLGQSRMRYHLPPYSPHHALTDAIATAELFQAQCAHHLPPHTAIQSLWL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.47 | 7.6e-8 | ●●○○○ -1.19 | -1.194008613355435 | 24331463 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)