Bacterial taxon 243277
Locus VC_0898
Protein NP_230545.1
exonuclease IX
Vibrio cholerae O1 biovar El Tor str. N16961
Length 283 aa, Gene xni, UniProt Q9KTK4
>NP_230545.1|Vibrio cholerae O1 biovar El Tor str. N16961|exonuclease IX
MGSNLDGFDYNKGLTSPYFLWFLVMSLHLVIIDALNLIRRVHSAQPDPNDITRTAETTTRTLQRIINEAQPSHMIAVFDHHLSDRGWRAELLPTYKANRKPMPDVLQQGIDAIQDAWWQLGIDSLLSEGDEADDLVATLACKVAAHQEKVTIISTDKGYCQLLSPTLQIRDYFQQRWLDEPFIAQEFGVTPAQLTDYWGLTGVSSSQIPGVAGIGPKAAKEILNQFSSIEEAYASPELPAKYRKKLDPHIEMARICKQVSALKTDIELGFNLQDIRFNSSSAD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1 | 1.1e-5 | ○○○○○ 0.87 | 0.8653564148893417 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)