Bacterial taxon 243277
Locus VC_0290
Protein NP_229945.1
Fis family transcriptional regulator
Vibrio cholerae O1 biovar El Tor str. N16961
Length 98 aa, Gene fis, UniProt P64127
>NP_229945.1|Vibrio cholerae O1 biovar El Tor str. N16961|Fis family transcriptional regulator
MFEQNLTSEALTVTTVTSQDQITQKPLRDSVKASLKNYLAQLNGQEVTELYELVLAEVEQPLLDTIMQYTRGNQTRAATMMGINRGTLRKKLKKYGMN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -3.24 | 6.1e-6 | ●●○○○ -1.09 | -1.0899250794697155 | 24331463 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)