Bacterial taxon 243277
Locus VC_A0178
Protein NP_232578.1
FrnE protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 217 aa, Gene n/a, UniProt Q9KMY8
>NP_232578.1|Vibrio cholerae O1 biovar El Tor str. N16961|FrnE protein
MHKLTIDLVSDIVCPWCVIGYFRLRHALARLPEVNVTLRWHPYELNPRLAIGGENLREHLNKKYGTSLEASQQARKTLTELGNDVGFAFHFFDEMRIYNTRKAHQLLLWAHQQDKQLPLTLALWSAYFQQGQAIDEDEVLLEIAQTVGLDRSACQQILTDESWANAVANTEQQWLQAGIHAVPTLIIEQKYLISGAQTSDILLDVLQRLTTKTDREH
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 1.62 | 2.0e-7 | ○○○○○ 1.4 | 1.401525740457151 | 24331463 |
Retrieved 1 of 1 entries in 29.2 ms
(Link to these results)