Bacterial taxon 243277
Locus VC_1551
Protein NP_231191.1
glycerol-3-phosphate ABC transporter permease
Vibrio cholerae O1 biovar El Tor str. N16961
Length 280 aa, Gene ugpE, UniProt Q9KRT5
>NP_231191.1|Vibrio cholerae O1 biovar El Tor str. N16961|glycerol-3-phosphate ABC transporter permease
MKSNRLSDHLILIAGALFMLVPLWLIFASSTHQPNTIVSEGLQWTLGDNLSAVYREAWNKSLGFAGNVTAQTMIVNSMIMGLGFAIGKIVISMMAAYALVYFRLPYASAWFWLIFITLLLPLEVRIIPSYEVVSNLGMLNSYTGLVLPLIASATATFFFRQFFKTIPDELLEAAQLDNAGPIRFFIDILFPLSKTMMAAIFIIMFVVGWNQYLWPIMMTTDEQYNTIVMGIKQILNNINETSLPRYDYAFAMVILAMLPPVLVVVIFQRWFVKGLVESEK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 0.68 | 0.008 | ○○○○○ 0.72 | 0.7186012747164163 | 24331463 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)