Bacterial taxon 243277
Locus VC_A0277
Protein NP_232674.1
glycine cleavage system protein H
Vibrio cholerae O1 biovar El Tor str. N16961
Length 126 aa, Gene gcvH, UniProt Q9KMP5
>NP_232674.1|Vibrio cholerae O1 biovar El Tor str. N16961|glycine cleavage system protein H
MDKTLKFTESHEWVRDNGDGTVTIGISEHAQEMLGDVVFVELPEIDAEIDAGDSFSLVESVKAASDIYAPVTGVVIEVNEDLQNSPELINEEPYDGGWIVKVKMSDPDELKDLKDAEEYLASIEED
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -2.61 | 3.8e-8 | ●●○○○ -1.31 | -1.309740806529679 | 24331463 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)