Bacterial taxon 243277
Locus VC_A0836
Protein NP_233222.1
hexapeptide repeat-containing acetyltransferase
Vibrio cholerae O1 biovar El Tor str. N16961
Length 192 aa, Gene n/a, UniProt Q9KLB0
>NP_233222.1|Vibrio cholerae O1 biovar El Tor str. N16961|hexapeptide repeat-containing acetyltransferase
MKMSELEKMLKGEHFDGASAEIEALRSQAGRLKLEINQSLDEAERYALQRELFGHLGHKSCVQPPFHCEFGKTIRIGDHTFINMNVVMLDGAPITIGDHVLIGPSTQFYTASHSLDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARILRSLKDPAESMAE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -4.58 | 3.3e-13 | ●●●○○ -2.58 | -2.577615091328816 | 24331463 |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)