Bacterial taxon 243277
Locus VC_0017
Protein NP_229676.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 38 aa, Gene n/a, UniProt Q9KVX1
>NP_229676.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MSKQEMKKPQLSLKEKRKLKQEKAQESSVIKPRKSKGR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | 3.67 | 0.0047 | ○○○○○ 2.1 | 2.0968081065622566 | 24331463 |
Retrieved 1 of 1 entries in 94.7 ms
(Link to these results)