Bacterial taxon 243277
Locus VC_0666
Protein NP_230315.2
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 83 aa, Gene n/a, UniProt Q9KU58
>NP_230315.2|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MRQSIYLQLAVLLVRAELRREERVWKRKVRRSSYHLPWNNPHLLRDIGLETDGRPIGLSLPDAVVAERRVRHIRRVLAARIPT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -5.16 | 5.3e-10 | ●●○○○ -1.97 | -1.9743744687884794 | 24331463 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)