Bacterial taxon 243277
Locus VC_0849
Protein NP_230496.1
hypothetical protein
Vibrio cholerae O1 biovar El Tor str. N16961
Length 146 aa, Gene ratA, UniProt P0C6Q0
>NP_230496.1|Vibrio cholerae O1 biovar El Tor str. N16961|hypothetical protein
MKMKQVSRSALVSFSAEQMFHLVNDVARYPEFLPGCSGSCVLEQSEAHMVASVDVSKAGISKTFTTSNQLTPGVSIAMSLVDGPFKTLRGGWFFTPLDEAACKVELRLEFEFSSKMIELAFGKIFNELTSNMVNAFTRRAKQVYGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 18 h | not available in this study | -6.15 | 5.0e-12 | ●●●○○ -2.43 | -2.4320017035175088 | 24331463 |
Retrieved 1 of 1 entries in 44.3 ms
(Link to these results)